Protein Info for RR42_RS17160 in Cupriavidus basilensis FW507-4G11

Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase" amino acids 10 to 334 (325 residues), 230.7 bits, see alignment E=1.1e-72 PF01565: FAD_binding_4" amino acids 24 to 154 (131 residues), 72.4 bits, see alignment E=3.2e-24 PF02873: MurB_C" amino acids 215 to 337 (123 residues), 90.3 bits, see alignment E=7.7e-30

Best Hits

Swiss-Prot: 82% identical to MURB_CUPNJ: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 82% identity to reu:Reut_A2761)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YD80 at UniProt or InterPro

Protein Sequence (338 amino acids)

>RR42_RS17160 UDP-N-acetylenolpyruvoylglucosamine reductase (Cupriavidus basilensis FW507-4G11)
MADFLEFYPLRRHNTFGFDVRARFAVHVRSEADLLAALADPRAQGLPLVVLGGGSNVVLT
RDLDALVLLMEIPGYAVASADAAHLVTAGAGENWHALVSRTIADGLPGLENLALIPGTAG
AAPIQNIGAYGVELRERFDSLRAFDRHSGEFVHLTLEQCQFAYRDSLFKREGRDRYIITA
VTLRLPLPWQPVLGYAELARELAQDSAAHSTADRIRDAVIAIRSRKLPDPAQVGNAGSFF
KNPVVGAEQRDALLVRYPDLVSHAQPDGSYKLAAGWLIDQCGFKGVSDGPVGVYGKQALV
LVHHGGGTGQALLALAHRIADAVQARFGVRIEPEPVVL