Protein Info for RR42_RS17090 in Cupriavidus basilensis FW507-4G11

Annotation: aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF00692: dUTPase" amino acids 20 to 158 (139 residues), 99.7 bits, see alignment E=1.1e-32 TIGR00576: dUTP diphosphatase" amino acids 20 to 158 (139 residues), 129.7 bits, see alignment E=3.4e-42

Best Hits

Swiss-Prot: 54% identical to DUT_TOLAT: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from Tolumonas auensis (strain DSM 9187 / TA4)

KEGG orthology group: K01520, dUTP pyrophosphatase [EC: 3.6.1.23] (inferred from 87% identity to reh:H16_A3049)

MetaCyc: 52% identical to dUTP diphosphatase (Escherichia coli K-12 substr. MG1655)
dUTP diphosphatase. [EC: 3.6.1.23, 3.6.1.9]

Predicted SEED Role

"Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.23 or 3.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJH0 at UniProt or InterPro

Protein Sequence (166 amino acids)

>RR42_RS17090 aminotransferase (Cupriavidus basilensis FW507-4G11)
MTFEANPTVEIKVLDARLHEWGLPAYQSDMAAAIDLHACLDAALTIEPGTPAQLVPAGIS
VHMGNPYMAATIAPRSGLGHKKGLVLGNSIGVIDADYQGPIMVSVWNRNAPGTEPIVIQP
GERIAQMMFVPVLRPVFKTVETFSEDTARGAGGFGSTGVHHAKSGS