Protein Info for RR42_RS17075 in Cupriavidus basilensis FW507-4G11

Annotation: peptidase A8

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 113 to 130 (18 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 28 to 176 (149 residues), 148 bits, see alignment E=1.2e-47 PF01252: Peptidase_A8" amino acids 34 to 173 (140 residues), 157.3 bits, see alignment E=1.5e-50

Best Hits

Swiss-Prot: 86% identical to LSPA_CUPNH: Lipoprotein signal peptidase (lspA) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 86% identity to reh:H16_A3047)

MetaCyc: 45% identical to lipoprotein signal peptidase (Escherichia coli K-12 substr. MG1655)
Signal peptidase II. [EC: 3.4.23.36]

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y602 at UniProt or InterPro

Protein Sequence (179 amino acids)

>RR42_RS17075 peptidase A8 (Cupriavidus basilensis FW507-4G11)
MAATTTRTTRGTKRAGSKGTKGSNATPLLWMAFALLVIVLDQFFKIIIVRTFAYGESRPV
TRFFNLVLVYNKGAAFSFLADAGGWQRWFFTGLGVVVGLFIIWMLYRHTGQRLFCFAISL
ILGGAIGNVVDRVVYGHVVDFLDFYVRNYHWPAFNVADCAITVGAVLLIVDELRRVRRH