Protein Info for RR42_RS16970 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 48 to 48 (1 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 145 to 162 (18 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 292 to 318 (27 residues), see Phobius details amino acids 344 to 362 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 50 to 338 (289 residues), 174.8 bits, see alignment E=1e-55

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 92% identity to reu:Reut_A2727)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YDF2 at UniProt or InterPro

Protein Sequence (386 amino acids)

>RR42_RS16970 ABC transporter ATP-binding protein (Cupriavidus basilensis FW507-4G11)
MNTPIPSPAAQAAPLTKTPAKTMAALLGFLIIALCAPFLVQTLGGNYWVRVLDFALIYIM
LALGLNIVVGFAGLLDLGYIAFYAVGAYMMALLGSPHLANQFEWIHQLFPNGLHLSMWFV
LPLAVLVAATFGVLLGAPTLKLRGDYLAIVTLGFGEIIRIFLNNLDRPLNITNGPKGITA
VDPVHIFGFDFSKSHEIFGLKFTPVFMYYYLLVVLVIAIVFICLRLQNSRIGRAFVAIRE
DEIAAKAMGINTRNIKLLAFAMGASFGGASGAVFGAFQGFVSPESFVLWESIYILAIVVL
GGMGHIPGVILGGILLVGFQELLRAVAEPAQNMIFGHTIVDAEVLRQLLFGLALVGVMLY
RPAGLWPSPRKEDRPVIRRPGSVGRF