Protein Info for RR42_RS16905 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): Imidazolonepropionase (EC 3.5.2.7)
Rationale: Specifically important for utilizing L-Histidine. Automated validation from mutant phenotype: the predicted function (IMIDAZOLONEPROPIONASE-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: imidazolonepropionase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 277 to 298 (22 residues), see Phobius details TIGR01224: imidazolonepropionase" amino acids 31 to 408 (378 residues), 484.4 bits, see alignment E=1e-149 PF01979: Amidohydro_1" amino acids 67 to 408 (342 residues), 61.9 bits, see alignment E=6.5e-21 PF07969: Amidohydro_3" amino acids 117 to 385 (269 residues), 45 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 84% identical to HUTI_CUPNJ: Imidazolonepropionase (hutI) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K01468, imidazolonepropionase [EC: 3.5.2.7] (inferred from 84% identity to reu:Reut_A2713)

MetaCyc: 65% identical to imidazolonepropionase (Pseudomonas fluorescens)
Imidazolonepropionase. [EC: 3.5.2.7]

Predicted SEED Role

"Imidazolonepropionase (EC 3.5.2.7)" in subsystem Histidine Degradation (EC 3.5.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y5X0 at UniProt or InterPro

Protein Sequence (420 amino acids)

>RR42_RS16905 Imidazolonepropionase (EC 3.5.2.7) (Cupriavidus basilensis FW507-4G11)
MSSSTESAKSADGVWHRCHLLPDGDPAKAIRDAALVVQQGRIVWLGMQAELPQAYAALPR
HDAGSAWITPGLVDCHTHLVYGGQRADEFAMRLAGAGYEEIARAGGGIVSTVRATRAADE
DTLFALAAARLAPLLAEGVTTLEIKSGYGLDLASERKQLRVARRLGDAFGVTVHTTFLGA
HALPPEYAGRADDYITLVCETMMPVLADEGLIDAVDAFCESVGFSLAQTERVFQAAERHG
LRVKLHAEQLSNLGGTALAARYRALSADHLEHLDEAGVVAMAGSGTVAVLLPGAYYFLRD
TNLPPIDLLRRHGVPMAISTDHNPGTSPVTSLLLMMNMACTLFRLTVPEVLAGVTTHAAR
ALGAADRHGLLAAGRAADFVLWNVDSPAELAYWFGRNPAAAVVRQGKVYPAATSVQGVRP