Protein Info for RR42_RS16555 in Cupriavidus basilensis FW507-4G11

Annotation: cysteine hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 138 to 157 (20 residues), see Phobius details PF00857: Isochorismatase" amino acids 26 to 197 (172 residues), 77.9 bits, see alignment E=5.3e-26

Best Hits

KEGG orthology group: None (inferred from 94% identity to reh:H16_B0623)

Predicted SEED Role

"Amidases related to nicotinamidase" in subsystem NAD and NADP cofactor biosynthesis global

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJ89 at UniProt or InterPro

Protein Sequence (204 amino acids)

>RR42_RS16555 cysteine hydrolase (Cupriavidus basilensis FW507-4G11)
MESAADAHDATMRTPAIVPAIAPAHTALVVMHYQTDILALFPSAAPTLLSNTRKLCDAAR
TKGVSVYFAKIHFGPGYPEVSPLNRNGQGIKQLGLFVDDQISPELGQQATEPLIIAHRAS
VFFGTDLQVRLSAQGIDTLLMVGIASTGVVLSSVAYASDADFRLFTVKDCCYDPDQVVHD
HLFSTAFDSRTTVLSLADALRLLA