Protein Info for RR42_RS16300 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 158 to 174 (17 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 46 to 250 (205 residues), 192.5 bits, see alignment E=8.3e-61 PF09850: DotU" amino acids 47 to 246 (200 residues), 185.8 bits, see alignment E=7.7e-59 TIGR03350: type VI secretion system peptidoglycan-associated domain" amino acids 278 to 413 (136 residues), 153.6 bits, see alignment E=3.1e-49 PF00691: OmpA" amino acids 310 to 407 (98 residues), 57.4 bits, see alignment E=1.5e-19

Best Hits

KEGG orthology group: K11892, type VI secretion system protein ImpK (inferred from 57% identity to reh:H16_B1137)

Predicted SEED Role

"Outer membrane protein ImpK/VasF, OmpA/MotB domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFG3 at UniProt or InterPro

Protein Sequence (415 amino acids)

>RR42_RS16300 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MDPQGIPSPEPDNKPAAGNDSQPTPRWIPPQRIFEQRLADVQRARNPILEASGRLVRCLC
DLPERLAPAETERLRELINEELDTFKALVERANVKREHVIASHYAICTALDDVVLQQEWG
QGWWASHSLLVQHHQDNLGGEKVYQVLGRLVESPHEHIAVIELIYYLMSLGFMGRYRTMT
DGDRQHHTIRQRLYDLLLKHYGPVPQELSPHIEAAPPGRFPRLYSVSPWMTAAVLAVVLL
GMFAWMKRELLLRQHDLLQQIEAIGRMTPPPWPQALHLAEWLKDEIARGVVTVHDNDRGA
TVVFRGDDIFRAGQADVNKRLLPTLNKVASEINKVQGKVQVIGHSDNQPIKSVRFPSNQV
LSEERAAVVSAYLASQGVAKGRLEAIGKGDSEPVGDNKTIAGRAANRRVEVVVTQ