Protein Info for RR42_RS16265 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): required for sulfate utilization, putative electron transport protein for sulfite reductase
Rationale: PFam PF06073.8 (DUF934). conserved cofitness with sulfite reductase; auxotrophic
Original annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 PF06073: DUF934" amino acids 74 to 180 (107 residues), 141 bits, see alignment E=6.1e-46

Best Hits

KEGG orthology group: None (inferred from 79% identity to reu:Reut_A2695)

Predicted SEED Role

"Oxidoreductase probably involved in sulfite reduction"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y5M4 at UniProt or InterPro

Protein Sequence (193 amino acids)

>RR42_RS16265 required for sulfate utilization, putative electron transport protein for sulfite reductase (Cupriavidus basilensis FW507-4G11)
MAKIIQLQRGEGANPVPVIIDDAWTVLRGAEGAALTDEQIAAAAQGKDAVLFPLAAWLAH
KDGVLAGRAADITGIWLAPEDEPADAQAAFASVAVVAVDFPVFRDGRGFSTAYLLRTRYN
WTGQLRAIGDVLRDQLNFMKRCGFDAFAVRADKNIDDAIKGFTEFTVAYQASVDEPLPLF
RRNRAEALGKETA