Protein Info for RR42_RS16260 in Cupriavidus basilensis FW507-4G11

Annotation: phosphoadenosine phosphosulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF01507: PAPS_reduct" amino acids 56 to 231 (176 residues), 140.6 bits, see alignment E=2.7e-45 TIGR02055: adenylylsulfate reductase, thioredoxin dependent" amino acids 58 to 255 (198 residues), 264.8 bits, see alignment E=2.3e-83

Best Hits

Swiss-Prot: 57% identical to CYSH_NEIMA: Phosphoadenosine phosphosulfate reductase (cysH) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 89% identity to reh:H16_A2997)

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8) / Adenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.10)" in subsystem Cysteine Biosynthesis (EC 1.8.4.10, EC 1.8.4.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.10 or 1.8.4.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJ39 at UniProt or InterPro

Protein Sequence (262 amino acids)

>RR42_RS16260 phosphoadenosine phosphosulfate reductase (Cupriavidus basilensis FW507-4G11)
MSEIAIVEAAVSSLRPPALWTAPEYTGSVADLEAKERALGLRLAEIAGRFFRARFASSLA
AEDMVVTDAILRGTEAVRAGIRVFTLQTGRLHAETLAVLDEVKAHYGYDIERFTPDPEAV
ENYLKNHGLNAFYDSVDLRKSCCGIRKVEPLNRALSHADAWLTGQRREQAVTRSELPFEE
MDEARGIPKFNPLADWSEAEVWAYLKRHQVPVNALHAKGYPSIGCEPCTRAVRAGEDVRA
GRWWWESKDSKECGLHEQNIKH