Protein Info for RR42_RS16155 in Cupriavidus basilensis FW507-4G11

Annotation: RNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF01878: EVE" amino acids 15 to 160 (146 residues), 187 bits, see alignment E=9.8e-60

Best Hits

KEGG orthology group: None (inferred from 84% identity to reu:Reut_A0651)

Predicted SEED Role

"FIG006231: RNA-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFE4 at UniProt or InterPro

Protein Sequence (164 amino acids)

>RR42_RS16155 RNA-binding protein (Cupriavidus basilensis FW507-4G11)
MSRSTQANAAARARQYWLMKSEPDEASIDTLAQRGTLPWTGVRNYQARNFMRDGMQIGDG
VLFYHSSCPQPGIAGLAEVSSQPYPDPTQFDPKSDYYDAAAKPDAPRWMLVDVRFIGKGP
LISLADLRAHDELADMVVLRRGNRLSITPVTPAEWRFITTRLMR