Protein Info for RR42_RS16135 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 61 to 83 (23 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 232 to 273 (42 residues), see Phobius details amino acids 283 to 306 (24 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details PF01032: FecCD" amino acids 19 to 332 (314 residues), 263.3 bits, see alignment E=1.3e-82

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 86% identity to reu:Reut_A0655)

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YD20 at UniProt or InterPro

Protein Sequence (335 amino acids)

>RR42_RS16135 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MPDMRRALAIWLMLAAAGVAVFLLSLAVGSVPLSGAQVWHALCGGADDTAGAIVRELRLP
RAAAAFACGGLLALTGALMQVLLRNPLAEPYVLGVSGGAATGALTAMLMMWPLWTVQAGA
AGGALFSMVLVATLARRDLLHPQVQGGHHEAGSRLLLTGVILAAGWGALITLILSVAPEA
RLRGMLFWLTGDLGGTASYGLALGALALAVLLAMPMARSLNAMLMGETVAQALGVRVGAV
RLSVFVLASLAIAVAITSAGSIGFVGLVVPHLVRLAWGNDQRLMLPASALLGGTLLMAAD
LVARTVIAPAQLPVGVITALLGVPTFLFLLLRRPR