Protein Info for RR42_RS15965 in Cupriavidus basilensis FW507-4G11

Annotation: formate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 140 to 162 (23 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details TIGR01583: formate dehydrogenase, gamma subunit" amino acids 174 to 376 (203 residues), 166.7 bits, see alignment E=3.4e-53 PF01292: Ni_hydr_CYTB" amino acids 176 to 354 (179 residues), 79.2 bits, see alignment E=1.7e-26

Best Hits

KEGG orthology group: K00127, formate dehydrogenase, gamma subunit [EC: 1.2.1.2] (inferred from 79% identity to reu:Reut_A0685)

Predicted SEED Role

"Formate dehydrogenase O gamma subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YIW5 at UniProt or InterPro

Protein Sequence (403 amino acids)

>RR42_RS15965 formate dehydrogenase (Cupriavidus basilensis FW507-4G11)
MKPTLNPGWFRYLAGVACALALLAPPGAARAQAQAPAQSASAPQAAGVPAEANNPATHPA
QPFAGIASENIFNVPRRDIAAEAQAQQARSKEQPGNNAPVWREANSDQAHYSSLPAKEAG
VLIQRTGQKWRLLRNGVITVWGGWLIVVVPAAILAFFFWRGTIPLKTLRTGRMIQRFTPL
ERMVHWTMAISFVTLAVSGIVMLFGKHFLLPLMGHTLFGWLTYLLKNVHNIVGPVFTLSV
IVGFVIFVRDNFPAREDWQWLIKLGGLVSGKHVPSGRFNAGEKAWFWGGLVVFGLILSAS
GWVLDMIVPGMDFYRATMQVANVIHGIAAVLMIAMACGHIYMGTIGMEGAYRAMRDGWVD
EAWAKEHHELWYDDIKAGKIAAQRAAEPEPGERAGGRASPGEV