Protein Info for RR42_RS15945 in Cupriavidus basilensis FW507-4G11

Annotation: deoxycytidine triphosphate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 4 to 187 (184 residues), 164.6 bits, E=9.5e-53
• PF00692: dUTPase
  • amino acids 82 to 184 (103 residues), 27.6 bits, E=1.1e-10

Best Hits

Swiss-Prot: 99% identical to DCD_CUPMC: dCTP deaminase (dcd) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 95% identity to rsl:RPSI07_1102)

MetaCyc: 70% identical to dCTP deaminase (Rickettsia prowazekii Madrid E)
dCTP deaminase. [EC: 3.5.4.13]

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

See A0A0C4Y5G4 at UniProt or InterPro

Protein Sequence (188 amino acids)

>RR42_RS15945 deoxycytidine triphosphate deaminase (Cupriavidus basilensis FW507-4G11)
MSIKSDKWIRRMAEQHGMIEPFEPGQVREEDGRKIVSYGTSSYGYDIRCADEFKIFTNIN
STIVDPKNFDEKSFVDFKGDVCIIPPNSFALARTMEYFRIPRSVLTICLGKSTYARCGII
VNVTPFEPEWEGYVTLEFSNTTPLPAKIYAGEGCAQVLFFESDEICETSYRDRGGKYQGQ
QGVTLPKT