Protein Info for RR42_RS15820 in Cupriavidus basilensis FW507-4G11

Annotation: UDP-glucose 6-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03721: UDPG_MGDP_dh_N" amino acids 1 to 186 (186 residues), 223.3 bits, see alignment E=2.9e-70 TIGR03026: nucleotide sugar dehydrogenase" amino acids 1 to 433 (433 residues), 441 bits, see alignment E=1.9e-136 PF00984: UDPG_MGDP_dh" amino acids 209 to 301 (93 residues), 123.5 bits, see alignment E=4.8e-40 PF03720: UDPG_MGDP_dh_C" amino acids 325 to 437 (113 residues), 110.5 bits, see alignment E=7.3e-36

Best Hits

Swiss-Prot: 49% identical to YWQF_BACSU: UDP-glucose 6-dehydrogenase YwqF (ywqF) from Bacillus subtilis (strain 168)

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 86% identity to rpf:Rpic12D_0578)

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YIS0 at UniProt or InterPro

Protein Sequence (453 amino acids)

>RR42_RS15820 UDP-glucose 6-dehydrogenase (Cupriavidus basilensis FW507-4G11)
MRITIIGTGYVGLVTGTCLAELGNNVFCVDVDAKKIDLLNNGGVPIYEPGLKALIDRNRA
AGRLKFSTDIAASVAHGDIQFIAVGTPPDEDGSADLKYVLEAARNIGRHMDSFKVIVDKS
TVPVGTADKVKAAVAEELKQRGSVHLDCAVVSNPEFLKEGAAVEDFMRPDRIVVGVASDE
AGEKAKAMMRTLYAPFNRNHERMYFMDVRSAEFTKYAANAMLATRISFMNELANLADRVG
ADIELVRQGIGSDPRIGYSFLYAGIGYGGSCFPKDVQALAKTAAQFGQSTYVLDAVEKVN
QAQKRVLVDKVLARFGNDIAGKRFAVWGLAFKPETDDMREAPSRIIIQELLDRGAIVQAH
DPVAMEEARRVLAQDLADRDGALEHLHFVDQPESALVGVDALIIVTEWKAFRSPDFDAMR
RDMKNPLIFDGRNLFDPSSMKKQGFEYFGIGRS