Protein Info for RR42_RS15465 in Cupriavidus basilensis FW507-4G11

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details TIGR02794: protein TolA" amino acids 18 to 382 (365 residues), 188.6 bits, see alignment E=2e-59 PF13103: TonB_2" amino acids 299 to 380 (82 residues), 76.9 bits, see alignment E=1.1e-25 TIGR01352: TonB family C-terminal domain" amino acids 324 to 382 (59 residues), 39.6 bits, see alignment E=5.2e-14 PF03544: TonB_C" amino acids 325 to 381 (57 residues), 25.9 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: K03646, colicin import membrane protein (inferred from 74% identity to reu:Reut_A0794)

Predicted SEED Role

"TolA protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YC69 at UniProt or InterPro

Protein Sequence (384 amino acids)

>RR42_RS15465 TonB-dependent receptor (Cupriavidus basilensis FW507-4G11)
MKTAAYPYQPAPERGTLRSFLLAVFMHLLLGIVLYFGVHWQSSTPVGAEAELWDEIPATT
APPPPPPPPAPQPIVQARPAPAAPAVRSRAEEDAEIALQQQKRRQAEAAAREEARQQADL
RARQEAERQEAARKEAARKDAQHKDDLRREERRREELKKDELKKDAQRKEDARRQAALQE
QRKEQVERERKEADAKARAEAKSRAEADARARAEADAKAKAAADAKAKANAEAKAAANAK
AKADADAKAKRDAAANAQRHSELARLQAMAGGGAAVGGAGGVGSSAGSGAGSGGKASPGY
PDRVRRRVKPNIVFTEDVPGNPAAVVSVQLAPDGSLMSARLSKSSGNSGWDNAVLRAVER
SDPLPRDENGKAPASFTITFKPKD