Protein Info for RR42_RS15460 in Cupriavidus basilensis FW507-4G11

Annotation: translocation protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 34 to 438 (405 residues), 512.8 bits, see alignment E=3.5e-158 PF04052: TolB_N" amino acids 41 to 140 (100 residues), 101.1 bits, see alignment E=7.6e-33 PF07676: PD40" amino acids 205 to 237 (33 residues), 30.6 bits, see alignment (E = 4.8e-11) amino acids 247 to 281 (35 residues), 41.4 bits, see alignment 2e-14 amino acids 289 to 325 (37 residues), 46.6 bits, see alignment 4.8e-16 amino acids 337 to 366 (30 residues), 22.8 bits, see alignment (E = 1.4e-08) amino acids 385 to 409 (25 residues), 15.9 bits, see alignment (E = 2.1e-06)

Best Hits

Swiss-Prot: 88% identical to TOLB_CUPNJ: Tol-Pal system protein TolB (tolB) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K03641, TolB protein (inferred from 88% identity to reu:Reut_A0795)

MetaCyc: 39% identical to Tol-Pal system periplasmic protein TolB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YIF7 at UniProt or InterPro

Protein Sequence (442 amino acids)

>RR42_RS15460 translocation protein TolB (Cupriavidus basilensis FW507-4G11)
MRKLWAPLWLAARRHGARAHALFAGLAVVLACSAGSAQAQLNVEITGVGASQFPIATANF
QGEAQAPQNLTAIIRSDLQRSGRFRNVDPGGATVAESANADLGSWKARGADAFVAGSVTP
TGNGQYDVRFRLYDTVKGTSLGGLAFTVSANQLRVTGHKIADYIYEKLLGERGVFATRLS
YVSRVGGRFQLLISDSDGQNSQVALTSNEPIISPSWSPDGSKVAYVSFEAKKPVVYVHDL
ATGKRTLVSNQKGNNSAPSWSPDGQRLAVALSRDGNTQIYQVGADGSGLKRLTRSSAIDT
EPQYAPDGRSIYFTSDRGGAPQIYRMPAGGEEGGAAQRVTFKGSYNVSPRISPDGKQLAY
ITRSGGFKLQLMDLGNGDVTSLTDTANDEAPSFAANGKYILYATRVGGRSVLAAVSTDGR
TRQVLSLQSGEVREPSWGPFMQ