Protein Info for RR42_RS15450 in Cupriavidus basilensis FW507-4G11

Annotation: Tol system periplasmic component YbgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 56 to 117 (62 residues), 68.6 bits, see alignment E=1.7e-22 TIGR02795: tol-pal system protein YbgF" amino acids 131 to 248 (118 residues), 128.9 bits, see alignment E=7.4e-42 PF13525: YfiO" amino acids 133 to 252 (120 residues), 39.4 bits, see alignment E=2.7e-13 PF09976: TPR_21" amino acids 133 to 232 (100 residues), 25.6 bits, see alignment E=4.4e-09 PF13432: TPR_16" amino acids 135 to 202 (68 residues), 23.1 bits, see alignment E=3.8e-08 PF13174: TPR_6" amino acids 170 to 201 (32 residues), 15.7 bits, see alignment 8.7e-06 amino acids 206 to 237 (32 residues), 21.5 bits, see alignment 1.2e-07 PF14559: TPR_19" amino acids 178 to 243 (66 residues), 29.3 bits, see alignment E=3.9e-10

Best Hits

KEGG orthology group: None (inferred from 82% identity to cti:RALTA_A2315)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YEP5 at UniProt or InterPro

Protein Sequence (252 amino acids)

>RR42_RS15450 Tol system periplasmic component YbgF (Cupriavidus basilensis FW507-4G11)
MKARASKLVLLTAMSCASLLPFAQARAGVFDDDEARKAIVNMRDQFNGFQATASQRIDQN
SRAQLDMQNQLEGLRQEVARLRGQNEMLQNEVTTLQKQQKDYYADLDARLKKFEPQQVTV
DGREGLSQPGEKTEYDAALKQFQTGDFKGAGNVFAGFIKKYPQSPYVPLAQFWLGNSLYA
QRDYRGSTSVLQNMVQAYPDHPKVPDALIAIANNQIESGQKPAARKTLEQVVAKYPGTEG
AQAASNRLKTLK