Protein Info for RR42_RS15440 in Cupriavidus basilensis FW507-4G11

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 313 to 335 (23 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details PF04143: Sulf_transp" amino acids 30 to 358 (329 residues), 218.2 bits, see alignment E=9.8e-69

Best Hits

KEGG orthology group: K07112, (no description) (inferred from 87% identity to cti:RALTA_A2313)

Predicted SEED Role

"Lipocalin-related protein and Bos/Can/Equ allergen" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y542 at UniProt or InterPro

Protein Sequence (371 amino acids)

>RR42_RS15440 transporter (Cupriavidus basilensis FW507-4G11)
MPEIDIAALSRTILASTFILTFLFGAVLQRTHFCTMGAVSDIVNMGDWTRMRMWGLAIGV
AMIGTSALAAGGYIDPTKTIYAASKLSWLSALVGGLMFGFGMVLASGCGSKTLVRIGAGN
LKSLVVFVFLGLSAYMTLRGLFGVIRVNTVDAVALTLPTTQDLPSVLAHASGMSRATLQV
GIALVVGGALVIWALAGRGLRTFDNLLGGLAVGLIIVAMWYVSGHLGYVAEDPNTLEELF
VASNSGRMESLSFVAPYAYTLDWLMMFSDKSKVLTIGIVSVFGVVAGAAAYALVTRTFRW
EGFGNAEDVGNHLVGGVLMGAGGVTALGCTIGQGLSGVSTLAIGSFIALAGILLGSVLGF
RYQIWRLERMI