Protein Info for RR42_RS15410 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 transmembrane" amino acids 70 to 88 (19 residues), see Phobius details PF05957: DUF883" amino acids 1 to 50 (50 residues), 53.3 bits, see alignment E=2.1e-18 PF19029: DUF883_C" amino acids 62 to 91 (30 residues), 66 bits, see alignment E=1.8e-22

Best Hits

Swiss-Prot: 35% identical to ELAB_ECOLI: Protein ElaB (elaB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to reu:Reut_A0803)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YIE4 at UniProt or InterPro

Protein Sequence (91 amino acids)

>RR42_RS15410 membrane protein (Cupriavidus basilensis FW507-4G11)
MSDVKTVLSDAEELLKQAASTTGEKAAELRERGMGLLKQAKEKAQDLQDAVVTKSKAAAR
ATDDYVHDHPWRAVGVAAGVGLLIGLLLNRK