Protein Info for RR42_RS15390 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): Tryptophan 2,3-dioxygenase (EC 1.13.11.11)
Rationale: Specifically important for utilizing L-Tryptophan. Automated validation from mutant phenotype: the predicted function (RXN-8665) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: tryptophan 2,3-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF03301: Trp_dioxygenase" amino acids 24 to 289 (266 residues), 226.8 bits, see alignment E=2.5e-71 TIGR03036: tryptophan 2,3-dioxygenase" amino acids 28 to 291 (264 residues), 454.9 bits, see alignment E=4.3e-141

Best Hits

Swiss-Prot: 86% identical to T23O_CUPNH: Tryptophan 2,3-dioxygenase (kynA) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00453, tryptophan 2,3-dioxygenase [EC: 1.13.11.11] (inferred from 86% identity to reh:H16_A2816)

MetaCyc: 38% identical to tryptophan 2,3-dioxygenase (Streptosporangium sibiricum)
Tryptophan 2,3-dioxygenase. [EC: 1.13.11.11, 1.13.11.52]

Predicted SEED Role

"Tryptophan 2,3-dioxygenase (EC 1.13.11.11)" in subsystem Aromatic amino acid degradation or NAD and NADP cofactor biosynthesis global (EC 1.13.11.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.11 or 1.13.11.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y532 at UniProt or InterPro

Protein Sequence (291 amino acids)

>RR42_RS15390 Tryptophan 2,3-dioxygenase (EC 1.13.11.11) (Cupriavidus basilensis FW507-4G11)
MSNHKGCPMSGAGATETSDASWHDAQMDFAKDMSYGDYLALDQILNAQHPLSPEHNEMLF
IVQHQTSELWMKLALHELRAARECVRQDQLPPAFKMLTRVSRIMEQLVQAWNVLATMTPP
EYSAMRPYLGMSSGFQSFQYREIEFILGNKNAAMLRPHAHQPQHLALLEEALRTPSLYDE
AIRLMARRGFAIDAACIERDWTRPAGENASVEAAWLEVYRKPEAHWELYELGEKFVDLED
AFRQWRFRHVTTVERVIGFKRGTGGTEGVSYLRKMLDVVLFPELWKLRTDL