Protein Info for RR42_RS15380 in Cupriavidus basilensis FW507-4G11

Annotation: kynurenine formamidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03035: arylformamidase
  • amino acids 16 to 220 (205 residues), 330.2 bits, E=3e-103
• PF04199: Cyclase
  • amino acids 18 to 163 (146 residues), 65.7 bits, E=2.9e-22

Best Hits

Swiss-Prot: 83% identical to KYNB_CUPNH: Kynurenine formamidase (kynB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K07130, (no description) (inferred from 83% identity to reh:H16_A2814)

Predicted SEED Role

"Kynurenine formamidase, bacterial (EC 3.5.1.9)" in subsystem Aromatic amino acid degradation or NAD and NADP cofactor biosynthesis global (EC 3.5.1.9)

MetaCyc Pathways

• L-tryptophan degradation IX (11/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (11/12 steps found)
• NAD de novo biosynthesis II (from tryptophan) (8/9 steps found)
• superpathway of NAD biosynthesis in eukaryotes (11/14 steps found)
• L-tryptophan degradation I (via anthranilate) (3/3 steps found)
• L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde (4/5 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (25/35 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis II (3/5 steps found)
• L-tryptophan degradation III (eukaryotic) (10/15 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis I (2/6 steps found)
• quinoxaline-2-carboxylate biosynthesis (4/10 steps found)
• 3-hydroxyquinaldate biosynthesis (2/8 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (11/23 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (21/42 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.9

Use Curated BLAST to search for 3.5.1.9

Sequence Analysis Tools

See A0A0C4YCE1 at UniProt or InterPro

Protein Sequence (221 amino acids)

>RR42_RS15380 kynurenine formamidase (Cupriavidus basilensis FW507-4G11)
MTNRPTPDTNDRPRQLWDISPALSPDTPVWPGDTPFQLERNWQIDAHCPVNVGRITLSPH
TGAHADAPLHYAADGAPIGEVDLAHYLGPCRVIHCIGVAPLVEPRHIGHALAGAPPRVLL
RTYQQAPLAKWDPDFCAVAPETIALLAEHGVMLVGIDTPSLDPQESKTMAAHNMVRRHRL
AILEGLVLDAVAEADYELIALPLRFAGLDASPVRAVLRSLA