Protein Info for RR42_RS15025 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details PF00892: EamA" amino acids 146 to 272 (127 residues), 32.1 bits, see alignment E=6.1e-12

Best Hits

KEGG orthology group: None (inferred from 84% identity to rme:Rmet_2619)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YC27 at UniProt or InterPro

Protein Sequence (306 amino acids)

>RR42_RS15025 membrane protein (Cupriavidus basilensis FW507-4G11)
MQSLWMLFAAFAFSLMGVGVKLASEIYATGEIVFYRSLIGVVIMWTVLASSGTSVRTPHM
AMHIKRSLFGVTALLLWFTSITMLPLATAMTLNYMSPVWIALILGAGAALTGTGGADRKL
IGAILMSFGGVICLLQPSVGHNQLTGGLIGLISGMFTALAYVEVRQLGQLGEPEGRIVFY
FSAVGMVVGLAWMLYTGPSTHTWRGAGLLLAIGILATLGQTAMTRAYKRGNTLLTANLQY
AGIVFSSLWGMIVWRDQLNWLSWVGMALIIASGIATTLTRAREGSNRQPTADTPVKSAEA
EVHPEV