Protein Info for RR42_RS15005 in Cupriavidus basilensis FW507-4G11

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 6 to 282 (277 residues), 397.1 bits, E=7.8e-123
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 7 to 622 (616 residues), 868 bits, E=1.9e-265
• PF00676: E1_dh
  • amino acids 114 to 184 (71 residues), 31.9 bits, E=1.4e-11
• PF02779: Transket_pyr
  • amino acids 320 to 479 (160 residues), 161 bits, E=4.5e-51
• PF02780: Transketolase_C
  • amino acids 506 to 616 (111 residues), 90.4 bits, E=1.7e-29

Best Hits

Swiss-Prot: 89% identical to DXS_CUPNJ: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 89% identity to reu:Reut_A0882)

MetaCyc: 57% identical to 1-deoxy-D-xylulose-5-phosphate synthase (Escherichia coli K-12 substr. MG1655)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (10/12 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• taxadiene biosynthesis (engineered) (10/13 steps found)
• methylerythritol phosphate pathway I (7/9 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• isoprene biosynthesis I (7/10 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Sequence Analysis Tools

See A0A0C4YI46 at UniProt or InterPro

Protein Sequence (636 amino acids)

>RR42_RS15005 1-deoxy-D-xylulose-5-phosphate synthase (Cupriavidus basilensis FW507-4G11)
MTYALLKTIDDPAALRRLDRRQLKTLADELRAYVLESVSQTGGHLSSNLGTVELTIALHY
VFNTPDDRVVWDVGHQSYPHKILTGRRDRMHSLRQWGGISGFPRRSESEYDTFGTAHSST
SISAALGMALGARTLGEKRVSIAVIGDGAMTAGMAFEAMNNAGVYKDLPLLVVLNDNDMS
ISPPVGALNSHLARLMSGKFYAATKKGIERVLSVAPPVLEFAKRFEEHAKGMMVPATLFE
EFGFNYIGPIDGHDLESLVPTLQNIRQRALEGGGPQFLHVVTKKGQGYKLAEADPILYHG
PGKFNPAEGIRPSTKPARKTYTQVFGEWLCDMAAADPKLVAVTPAMREGSGMVEFEKRFP
SRYYDVGIAEQHAVTFAGGLACEGLKPVLAIYSTFLQRGYDQLIHDVALQNLPVVFALDR
AGLVGADGATHAGAYDIAFLRCIPNMMVMTPADENECRQLLTTAYQQDCPTAVRYPRGAG
TGVATGAALTALPVGKGEMRRTGGARAGQRVAFLAFGSMLHPALGAAEALDASVANMRFV
KPLDEELVKKLASEHDYLVTVEEGCVMGGAGSAVLEALAAAGIAMPVLQLGLPDRFVDHG
DPAFLLSQCGLDAKGIEQSVRERFNLAQPAVATRAA