Protein Info for RR42_RS14995 in Cupriavidus basilensis FW507-4G11

Annotation: tRNA threonylcarbamoyladenosine modification protein TsaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 TIGR03723: tRNA threonylcarbamoyl adenosine modification protein TsaD" amino acids 3 to 314 (312 residues), 430.8 bits, see alignment E=2.8e-133 TIGR00329: metallohydrolase, glycoprotease/Kae1 family" amino acids 4 to 307 (304 residues), 374.5 bits, see alignment E=4e-116 PF00814: TsaD" amino acids 24 to 308 (285 residues), 313.8 bits, see alignment E=6.1e-98

Best Hits

Swiss-Prot: 91% identical to TSAD_CUPNH: tRNA N6-adenosine threonylcarbamoyltransferase (tsaD) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K01409, O-sialoglycoprotein endopeptidase [EC: 3.4.24.57] (inferred from 91% identity to reu:Reut_A0884)

MetaCyc: 59% identical to N6-L-threonylcarbamoyladenine synthase, TsaD subunit (Escherichia coli K-12 substr. MG1655)
RXN-14570 [EC: 2.3.1.234]

Predicted SEED Role

"TsaD/Kae1/Qri7 protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.234 or 3.4.24.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YEB9 at UniProt or InterPro

Protein Sequence (346 amino acids)

>RR42_RS14995 tRNA threonylcarbamoyladenosine modification protein TsaD (Cupriavidus basilensis FW507-4G11)
MLVLGIESSCDETGLALYDTQSGLLAHALHSQIAMHRDYGGVVPELASRDHIRRVLPLLQ
QVLDEAGRTRADINAIAFTQGPGLAGALLVGASVANALGFALNVPMLGVHHLEGHLLSPL
LTANPPPFPFVALLVSGGHTQLMEVRGIGDYALLGETLDDAAGEAFDKTAKLLGLSYPGG
PEVSRLAEFGVPGTYALPRPMLHSGTLDFSFAGLKTAVLTQTRKLGNVCEQDRANLARSF
VDAIVDVLAAKSMAALKQTGHRRLVVAGGVGANRQLRERLNQLGAQKKIEVYYPDLAFCT
DNGAMIAFAGAMRLQAAPELAKRDYGYGVTPRWELSDIRLPERPAA