Protein Info for RR42_RS14935 in Cupriavidus basilensis FW507-4G11

Annotation: biopolymer transporter ExbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 366 to 393 (28 residues), see Phobius details amino acids 501 to 525 (25 residues), see Phobius details amino acids 535 to 557 (23 residues), see Phobius details PF10102: DUF2341" amino acids 72 to 137 (66 residues), 67.9 bits, see alignment E=1.4e-22 PF13385: Laminin_G_3" amino acids 197 to 334 (138 residues), 58.7 bits, see alignment E=1.2e-19 PF01618: MotA_ExbB" amino acids 464 to 570 (107 residues), 97.6 bits, see alignment E=7.2e-32

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 80% identity to mms:mma_2379)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4U2 at UniProt or InterPro

Protein Sequence (599 amino acids)

>RR42_RS14935 biopolymer transporter ExbB (Cupriavidus basilensis FW507-4G11)
MRRILLLVLTLLSTLLPDLAHAWWQPDWAYRKPITIDAGPKAGAIGGDAGRTPVLLRLHT
GNFSFEGVSETGADLRFVAADDKTVLNHQIEQFDPLLGIALIWIDVPSVSAAGPQQLWMY
YGNAKAPASGNGQRTFDPDYTLVYHFAEGSVPARDTTAYGNHSQTAVVSVDGTVIGKGAQ
LGAAPLVLPSSPSLAQAAGAPFGFSAWVRPEKLGPQQVVYARRDGAGELVIGIDQGVPFV
QVNGQRSNPGQPVQAGQWSHLAVKSDGKSVSLYVGGRPAASLATALPALNTPATLGADAA
AGAAPNAPAAATALSPFSGAIDEVRLSKVARPDALILADAVSQGAESRLAVFGADEQQAG
KSHFGFILAAMPLDAWIVVGLLGIMMALSWAIMISKGRSYGATSRANAAFMVHFREAAGA
PLDQLAKSNRVPEAVKADSSLWRLYEMAVEELHRRHQMGYDLNAVSDATISAIRAAMDGV
MVRESERMAKRMNWLSTTIEGAPYVGLFGTVIGIMLVFVVAAMAGAVDINSVAPGMAAAL
LCTAAGLGVAIPALFGYNWLASRSDSIGADMAVFVDEFATRLAEEQGEGRRVPAALHRA