Protein Info for RR42_RS14910 in Cupriavidus basilensis FW507-4G11

Annotation: peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF13145: Rotamase_2" amino acids 137 to 270 (134 residues), 62.2 bits, see alignment E=1.2e-20 PF13616: Rotamase_3" amino acids 154 to 257 (104 residues), 64.6 bits, see alignment E=1.9e-21 PF00639: Rotamase" amino acids 164 to 255 (92 residues), 69 bits, see alignment E=8.7e-23

Best Hits

KEGG orthology group: K01802, peptidylprolyl isomerase [EC: 5.2.1.8] (inferred from 69% identity to mms:mma_2374)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4T8 at UniProt or InterPro

Protein Sequence (313 amino acids)

>RR42_RS14910 peptidylprolyl isomerase (Cupriavidus basilensis FW507-4G11)
MKSHAQSMLPPVRAAIGVLLASWLSAAPVQAAEPATASGPVVARAGSVTVGQDDVERLLQ
GLPEADRAAARSNRAGIENWLRQRLASEALLREAQGKGWAERPEVKARVDAAMREISARI
VASTYLESVAQLPAGYPSEPEVNAAYEGGKANFQVPASYRVAQIFLATQGSDAAATAKVR
DEARKLATQARQGDFAALAKSRSQDPRGAERGGEVGALPLAQMLPEVRDTVARLKVGQVS
DPVQSAAGFHVMKLLDTQAGRIATLDEIKPQLVAAMRQQRQQQLVQAYMARLVAPGAASI
DTAALDAVLHKAN