Protein Info for RR42_RS14665 in Cupriavidus basilensis FW507-4G11

Annotation: DNA topoisomerase IV subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 783 TIGR01062: DNA topoisomerase IV, A subunit" amino acids 19 to 714 (696 residues), 748.8 bits, see alignment E=2.8e-229 PF00521: DNA_topoisoIV" amino acids 41 to 499 (459 residues), 473.2 bits, see alignment E=8.2e-146 PF03989: DNA_gyraseA_C" amino acids 628 to 663 (36 residues), 7.9 bits, see alignment (E = 0.00023) amino acids 677 to 722 (46 residues), 25.8 bits, see alignment 5.9e-10

Best Hits

KEGG orthology group: K02621, topoisomerase IV subunit A [EC: 5.99.1.-] (inferred from 87% identity to reh:H16_A2667)

Predicted SEED Role

"Topoisomerase IV subunit A (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBV5 at UniProt or InterPro

Protein Sequence (783 amino acids)

>RR42_RS14665 DNA topoisomerase IV subunit A (Cupriavidus basilensis FW507-4G11)
MEQQDIPLDPGSPDNGADSLTLAHYAERAYLDYAISVVKGRALPEVADGQKPVQRRILYA
MHEMGLRSDAKPVKSARVVGDVLGKFHPHGDQSAYDALVRLAQDFSLRYPLIDGQGNFGS
RDGDGAAAMRYTEARLTPIARLLLDEIDQGTVDFIPNYDGSMEEPRLMPARLPFVLLNGA
SGIAVGMATEVPPHNLREVAAATVAMIRNPNITLAELLALMPGPDYPGGGQIISPAADIA
QIYENGRGSLKVRARWIIEEMARGQWQLVVTELPPSTSSQKVLEEIEEITNPKVRAGKKS
LTPEQLQLKQGMLAVLDAVRDESGKNAPVRLVFEPKSKNIEQQEFIQTLLAHTSLESGAS
INLVMIGTDGRPRQKGLADILREWIAFRFATVTRRTRHRLGKVEDRIHILEGRMLVLLNI
DEVIRIIRESDEPKPALMQAFGLSDRQAEDILEIRLRQLARLEALRIEQELKSLRDEQAE
LDVLLKSETMMRRRIIKEIETDAKQYSPEDKDPRRTLIQEERRANAEVRVVDEPVTVVVS
QKGWVRTRQGHGHDAQQFTFKAGDALYGTFECRSVDVMLVFGTNGRAYTVPVAGLPGGRG
DGVPVTTLIELQPGSQIAHTFAGSVDQRLLIATRGGNGFQTKVGDMVSRQKGGRAYLTLD
EGDAPLLPAPIGEEATHVACLSANGRMLLVALDEIKSLSAGGRGVILMELEPKETLQQAI
AVGAPGLVVSGAGRGGKPSSQKLYGQLLLPYVGKRARKGRALDLKLKEPSIEPVRIVPPA
SGN