Protein Info for RR42_RS14650 in Cupriavidus basilensis FW507-4G11

Annotation: multidrug ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 transmembrane" amino acids 36 to 62 (27 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 269 to 292 (24 residues), see Phobius details amino acids 298 to 323 (26 residues), see Phobius details PF00664: ABC_membrane" amino acids 84 to 305 (222 residues), 48.3 bits, see alignment E=1.1e-16 PF00005: ABC_tran" amino acids 379 to 532 (154 residues), 116.7 bits, see alignment E=1.3e-37

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 82% identity to reh:H16_A2666)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4P8 at UniProt or InterPro

Protein Sequence (610 amino acids)

>RR42_RS14650 multidrug ABC transporter ATP-binding protein (Cupriavidus basilensis FW507-4G11)
MLMRFLERLIDPFRALPDTQPPGQIWRFYAYFLREVWPVFALLLGVGLAGALIEVSLFGF
LGRLVDLAQATPPAEFFARHRGELVWMAVVALLLRPFFNGLHDILVHQVINPSLGNLVRW
QNHRYVLKQSLSFFQNDFAGRIAQRIMQTGFSLRDSAVQAVDAIWHVLIYAASSLYLFAQ
ADWRLMIPLVAWIACYVAAMLYFTPRVKARSVAATGARSRLMGRIVDGYTNITTLKLFAH
TRHEEDYAREAMADLTDKARLSGRMVSAMDFTVTSLNGLLIAGTTGLALWLWSQGHVSVG
AIALSSGLVIRIVSMSGWIMWVISGIFENIGQVQDGLQTIAVPRTVGDRDNAQALRITRG
EVRFEGVGFHYGKGSGVIENIDLVVRPGEKIGLVGPSGAGKSTLVNLLLRLYDVEQGRIL
IDGQDIAGVTQESLRAQIGMVTQDTSLLHRSIRDNLRYGRPGASEAELLTTANDAHAGEF
IPRLRDAHGATGLDAQVGERGVKLSGGQRQRIAVARVLLKNAPILILDEATSALDSEVEA
AIQENLETLMQGKTVIAIAHRLSTIARMDRLVVLEDGRIAESGTHAELLARGGLYARLWA
HQTGGFVGVE