Protein Info for RR42_RS14415 in Cupriavidus basilensis FW507-4G11

Annotation: leucine/isoleucine/valine transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 99 to 115 (17 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details amino acids 200 to 216 (17 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details amino acids 320 to 339 (20 residues), see Phobius details amino acids 355 to 380 (26 residues), see Phobius details amino acids 391 to 408 (18 residues), see Phobius details PF11862: DUF3382" amino acids 19 to 110 (92 residues), 81.8 bits, see alignment E=3.7e-27 PF02653: BPD_transp_2" amino acids 119 to 405 (287 residues), 183.3 bits, see alignment E=5.4e-58

Best Hits

Swiss-Prot: 60% identical to LIVM_SALTY: High-affinity branched-chain amino acid transport system permease protein LivM (livM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 88% identity to reh:H16_A2624)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YE09 at UniProt or InterPro

Protein Sequence (424 amino acids)

>RR42_RS14415 leucine/isoleucine/valine transporter permease subunit (Cupriavidus basilensis FW507-4G11)
MTQAISTPIGMTQGAPAGQTLKNAIVAAVMTAILTIPVLGLQLKLDGYKVVLEPHWQPVW
LAVGAVFLFQLFKPLFQRATAGIKVPSLPALGATQQRKVIWLLLAVGLVFPFFSSRGAVD
VATLALIYVILGLGLNIVVGYAGLLDLGYVGFYAVGGYTYALLNQYFGLTFWECLPIAAG
MSALFGFVLGFPVLRLRGDYLAIVTLGFGEIIRLLLNNLTSLTGGPDGVSGIPKPTVFGI
EMARSASVEGVKTFHELLGWDYSGEHMVIFLYLLALLLVGFTLFVTSRLIRMPMGRAWEA
LREDEIACRSLGLNPTRIKLSAFTLGAAFAGLGGAFFAARQGLVNPESFTFIESALILAV
VVLGGMGSQLGVILAAILLTALPEMARGFAEYRMLIFGLVMVLMMMWRPQGLLPASRPHV
ELPQ