Protein Info for RR42_RS14205 in Cupriavidus basilensis FW507-4G11

Annotation: nicotinate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01514: nicotinate phosphoribosyltransferase
  • amino acids 2 to 387 (386 residues), 482.8 bits, E=4.4e-149
• PF17767: NAPRTase_N
  • amino acids 7 to 128 (122 residues), 131.3 bits, E=2.5e-42
• PF04095: NAPRTase
  • amino acids 164 to 388 (225 residues), 268.1 bits, E=8e-84

Best Hits

Swiss-Prot: 86% identical to PNCB_CUPNH: Nicotinate phosphoribosyltransferase (pncB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 86% identity to reh:H16_A2589)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• superpathway of NAD biosynthesis in eukaryotes (11/14 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• NAD salvage (plants) (6/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.11

Sequence Analysis Tools

See A0A0C4YBH7 at UniProt or InterPro

Protein Sequence (392 amino acids)

>RR42_RS14205 nicotinate phosphoribosyltransferase (Cupriavidus basilensis FW507-4G11)
MIITSLLDTDLYKFTMMQVVLHHFPAAQVEYRFKCRNAGVDLTPYVDEIREEVAQLCQVR
FTPDELQYLRELRFIKSDFVDFLDLFHLNEKYVTIAPAAPGSGEIEITIRGPWLHTILFE
VPLLAIVNEVYFRRTQPQPDWSEGRKRLEDKLALLKMPAHADCVIADYGSRRRFSRDWQE
EVLQTMRRVLGPQLAGSSNVHFARTHNLVPLGTMAHEYLQACQALGPRLRDSQVFALEVW
AKEYRGDLGIALSDTYGFDAFLRDFDLYFCKLFDGVRHDSGDPIAWGERMLAHYAAGRVD
PQGKTLIFSDSLDIPRVIELYERFGGRCRLAFGVGTNLTNDLGYTPLQIVIKMTRCNGQP
VAKLSDTPEKTMCDDPAYLAYLRQVFGIKAPA