Protein Info for RR42_RS14110 in Cupriavidus basilensis FW507-4G11

Annotation: 3-oxoacyl-ACP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 4 to 326 (323 residues), 409.1 bits, see alignment E=6e-127 PF00108: Thiolase_N" amino acids 52 to 152 (101 residues), 32.6 bits, see alignment E=8.2e-12 PF08545: ACP_syn_III" amino acids 114 to 191 (78 residues), 116.6 bits, see alignment E=5.4e-38 PF08541: ACP_syn_III_C" amino acids 238 to 326 (89 residues), 119.3 bits, see alignment E=9.8e-39

Best Hits

Swiss-Prot: 90% identical to FABH_CUPTR: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 90% identity to cti:RALTA_A2072)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBG1 at UniProt or InterPro

Protein Sequence (326 amino acids)

>RR42_RS14110 3-oxoacyl-ACP synthase (Cupriavidus basilensis FW507-4G11)
MTSYAKIIGTGSYLPPRRVTNQDIAAQLAEKGIETSDEWIFSRSGISARHWAEPDVTSSD
LAVKAAERALEAAGIDRQSIDLIIVATSTPDFVFPSTACLVQQKLGITNNCAAFDLQAVC
SGFVYALATAEKFIRSGSHRNALVIGSEVFSRILDFNDRTTCVLFGDGAGAVVLSASEEP
GILSSAMHSDGSHVDILCVPGNVAGGNITGNPFLHMDGQAVFKLAVTVLDKVAREALAGA
QFPAEKVDWLIPHQANIRIMQSTARKLGLPAERMVATVHEHGNTSAASIPLALDVAVRDG
RIHAGHHVLMEGVGGGFTWGAVLLRM