Protein Info for RR42_RS14110 in Cupriavidus basilensis FW507-4G11

Annotation: 3-oxoacyl-ACP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III
  • amino acids 4 to 326 (323 residues), 409.1 bits, E=6e-127
• PF00108: Thiolase_N
  • amino acids 52 to 152 (101 residues), 32.6 bits, E=8.2e-12
• PF08545: ACP_syn_III
  • amino acids 114 to 191 (78 residues), 116.6 bits, E=5.4e-38
• PF08541: ACP_syn_III_C
  • amino acids 238 to 326 (89 residues), 119.3 bits, E=9.8e-39

Best Hits

Swiss-Prot: 90% identical to FABH_CUPTR: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 90% identity to cti:RALTA_A2072)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• streptorubin B biosynthesis (20/34 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

See A0A0C4YBG1 at UniProt or InterPro

Protein Sequence (326 amino acids)

>RR42_RS14110 3-oxoacyl-ACP synthase (Cupriavidus basilensis FW507-4G11)
MTSYAKIIGTGSYLPPRRVTNQDIAAQLAEKGIETSDEWIFSRSGISARHWAEPDVTSSD
LAVKAAERALEAAGIDRQSIDLIIVATSTPDFVFPSTACLVQQKLGITNNCAAFDLQAVC
SGFVYALATAEKFIRSGSHRNALVIGSEVFSRILDFNDRTTCVLFGDGAGAVVLSASEEP
GILSSAMHSDGSHVDILCVPGNVAGGNITGNPFLHMDGQAVFKLAVTVLDKVAREALAGA
QFPAEKVDWLIPHQANIRIMQSTARKLGLPAERMVATVHEHGNTSAASIPLALDVAVRDG
RIHAGHHVLMEGVGGGFTWGAVLLRM