Protein Info for RR42_RS13815 in Cupriavidus basilensis FW507-4G11

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 PF12831: FAD_oxidored" amino acids 27 to 70 (44 residues), 29.1 bits, see alignment 1.3e-10 PF00890: FAD_binding_2" amino acids 27 to 67 (41 residues), 24.3 bits, see alignment 3.6e-09 PF01266: DAO" amino acids 27 to 387 (361 residues), 191.9 bits, see alignment E=5e-60 PF16901: DAO_C" amino acids 408 to 515 (108 residues), 53.1 bits, see alignment E=6e-18

Best Hits

KEGG orthology group: K00111, glycerol-3-phosphate dehydrogenase [EC: 1.1.5.3] (inferred from 87% identity to reh:H16_A2508)

Predicted SEED Role

"Aerobic glycerol-3-phosphate dehydrogenase (EC 1.1.5.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Respiratory dehydrogenases 1 (EC 1.1.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.5.3

Use Curated BLAST to search for 1.1.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YDP1 at UniProt or InterPro

Protein Sequence (534 amino acids)

>RR42_RS13815 FAD-dependent oxidoreductase (Cupriavidus basilensis FW507-4G11)
MQTLHTPILPPERATLLATLEREPKWDVIVIGGGATGLGTAVDAASRGYRTLLVEAADFA
KGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLARNAPHLVWPLGFVVPAYQLFDQP
FYGIGLKLYDMLAGGLNLSGSRWLNHRETLAAAPTLAEHVGGRPLRGGNLYFDGQFDDAR
LAIALMRTLFDVGGTAINYLRVSGLSQRNGVIDGVTVQDVLGDASFDLKASCVINATGVW
VDAVRQMEDGQARSMVAPSQGVHLTLPRSFLPGDRAILIPKTDDGRVLFVVPWNGHTIIG
TTDTPRKDLPLEPRAGADDVDFILETATRYLSRAPTRADVTSVWAGLRPLVKATGEASTA
SLSREHTILVSKAGLITVTGGKWTTYRKMAEDVVGTAIQRQMLPAAPCVTADLPLHGAQG
LPANLPAPGSGSPDRYYGNEAGMLHTLPGNDEMLVPGAGLTAAHVRFAARFELARRVEDV
LARRNRALFLEASAASAAAPRVAEILAEEHGHDAAWQAAEVASFRELASGYMLA