Protein Info for RR42_RS13800 in Cupriavidus basilensis FW507-4G11

Annotation: formyltetrahydrofolate deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13740: ACT_6
  • amino acids 6 to 38 (33 residues), 26.6 bits, 7.2e-10
• TIGR00655: formyltetrahydrofolate deformylase
  • amino acids 7 to 287 (281 residues), 332 bits, E=1.8e-103
• PF01842: ACT
  • amino acids 7 to 53 (47 residues), 32.2 bits, 1.1e-11
• PF00551: Formyl_trans_N
  • amino acids 90 to 269 (180 residues), 131.8 bits, E=3.8e-42

Best Hits

Swiss-Prot: 50% identical to PURU_CORS1: Formyltetrahydrofolate deformylase (purU) from Corynebacterium sp. (strain P-1)

KEGG orthology group: K01433, formyltetrahydrofolate deformylase [EC: 3.5.1.10] (inferred from 92% identity to reu:Reut_A2211)

Predicted SEED Role

"Formyltetrahydrofolate deformylase (EC 3.5.1.10)" in subsystem One-carbon metabolism by tetrahydropterines (EC 3.5.1.10)

MetaCyc Pathways

• formaldehyde oxidation VII (THF pathway) (4/4 steps found)
• folate transformations I (9/13 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.10

Sequence Analysis Tools

See A0A0C4YHN7 at UniProt or InterPro

Protein Sequence (288 amino acids)

>RR42_RS13800 formyltetrahydrofolate deformylase (Cupriavidus basilensis FW507-4G11)
MSNTGFILTISCPDQPGIVHAVSGLLFQHGCNIVDSDQYGDEFTGRFFMRVHFTPAAGGP
DLATLKTAFAPIGDQFAMQWDLFDASVKPRVMIMVSKIGHCLNDLLFRAKASGLPVEIAA
IVSNHRDFYQLAASYDIPFFHLPMMNASAEQKAAQENKVFEIVREQNIDLVVLARYMQVL
SDDLCRKLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTAALDEGPIIEQE
IERVDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVFK