Protein Info for RR42_RS13750 in Cupriavidus basilensis FW507-4G11

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 66 (27 residues), see Phobius details amino acids 89 to 112 (24 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 336 to 361 (26 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 401 to 422 (22 residues), see Phobius details amino acids 428 to 447 (20 residues), see Phobius details PF00324: AA_permease" amino acids 20 to 420 (401 residues), 61.6 bits, see alignment E=6e-21 PF13520: AA_permease_2" amino acids 32 to 426 (395 residues), 118.7 bits, see alignment E=3.2e-38

Best Hits

KEGG orthology group: None (inferred from 70% identity to rsl:RPSI07_mp1079)

Predicted SEED Role

"cell processes; transport of small molecules; amino acids, amines"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YHN1 at UniProt or InterPro

Protein Sequence (464 amino acids)

>RR42_RS13750 amino acid permease (Cupriavidus basilensis FW507-4G11)
MDRNSPATLDAGALGLGESVVMGVAGTAPAFSLAATTATLVAMVGSLAPASLLYCGLIMF
GVTLSYQQLNRLQPSAGACYTWVCEIFHPVLGFFAGWTLLVASAVFMVSGTIPAATATLL
LLDPALAERPPVVTLVAAGWLLAVSVVVVKGVKLTSYTQVAMTLVEVGVLGAIVLAALLR
APLPLAHPPSLAMLSPFGFTPQLFANGALVALFFFWGWDVTANLTEETRDPARAPGRGAL
MAMVIVLALFMAFVIASQAVLSDQEIRRAGTNVVFALAARLFPRPWDYLAVLAVMLSTVG
TLETSILQFTRTLYAKGRDGLLHPRYAELHRTWRTPWVATAVIASFGLLLLALSACFNSV
GQIIQDSVNAIGFQVAFYYGLAGFACAWHCRRGSARAPARLLLLVLWPACSAAFLWFIGL
YSIPSFDLATRVVALGGIAVGAAPLWFNRRRRLAARAALRAPGP