Protein Info for RR42_RS13650 in Cupriavidus basilensis FW507-4G11

Annotation: ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 PF00175: NAD_binding_1" amino acids 114 to 201 (88 residues), 22.7 bits, see alignment E=1.3e-08 PF00111: Fer2" amino acids 239 to 307 (69 residues), 52.6 bits, see alignment E=3.5e-18

Best Hits

Swiss-Prot: 49% identical to POBB_PSEPS: Phenoxybenzoate dioxygenase subunit beta (pobB) from Pseudomonas pseudoalcaligenes

KEGG orthology group: None (inferred from 82% identity to cti:RALTA_B0575)

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1; Vanillate O-demethylase oxidoreductase (EC 1.14.13.-)" (EC 1.14.13.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBD1 at UniProt or InterPro

Protein Sequence (318 amino acids)

>RR42_RS13650 ferredoxin (Cupriavidus basilensis FW507-4G11)
MSTSQSLSLRVQAMRFEARGIVSVELRDPHGHALPEYAPGAHIDLHLGNGLVRSYSLCGA
PELRDRYVVGVLLDRGSRGGSRYVHEQLRVGSTLTVAAPRNHFALDEDAAHTVLVAGGIG
VTPIVCMARRLHELGRSFTLLYCARSRAEAAFADELAAYGDAVRMHFDDEAGSPPDLSAL
LAGQAASTHFYCCGPGPMLNAFEAACAGHGYPEVHIERFAADPSVAAVQDGEYTVALAST
GSELKVPAGKSLLDALLEAGIAVEHSCREGVCGSCETRVLEGIPEHRDGVLSKSERESNQ
TMMVCVSGCKGKRLVLDL