Protein Info for RR42_RS13625 in Cupriavidus basilensis FW507-4G11

Annotation: 4-hydroxybenzoyl-CoA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00941: FAD_binding_5
  • amino acids 3 to 173 (171 residues), 167.5 bits, E=2.5e-53
• PF03450: CO_deh_flav_C
  • amino acids 195 to 280 (86 residues), 63.2 bits, E=2.1e-21

Best Hits

KEGG orthology group: K03519, carbon-monoxide dehydrogenase medium subunit [EC: 1.2.99.2] (inferred from 78% identity to reh:H16_B0744)

Predicted SEED Role

"Xanthine dehydrogenase, FAD binding subunit (EC 1.17.1.4)" in subsystem Purine Utilization (EC 1.17.1.4)

MetaCyc Pathways

• adenosine nucleotides degradation II (4/5 steps found)
• guanosine nucleotides degradation II (3/4 steps found)
• guanosine nucleotides degradation III (3/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• ureide biosynthesis (5/7 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• superpathway of guanosine nucleotides degradation (plants) (3/6 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• superpathway of purines degradation in plants (11/18 steps found)
• caffeine degradation III (bacteria, via demethylation) (1/7 steps found)
• theophylline degradation (1/9 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (1/10 steps found)

KEGG Metabolic Maps

• Methane metabolism
• Purine metabolism
• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4, 1.2.99.2

Use Curated BLAST to search for 1.17.1.4 or 1.2.99.2

Sequence Analysis Tools

See A0A0C4YDK3 at UniProt or InterPro

Protein Sequence (288 amino acids)

>RR42_RS13625 4-hydroxybenzoyl-CoA reductase (Cupriavidus basilensis FW507-4G11)
MRNFEFLEPGSVPEASRMLADLGDECRVIAGGTALMLGMRQRMLMPTHLVSLGQLDALRK
IEFDPRTGLRIGALALHAQVARSPLVQAHYPMLASMAGRVANPQVRNQGTIGGNLCYADP
ATDPPGCLMALGAQVVLAGRSGERVLEMEAFLVDYYTTALEPDEIVTEIRIPALAPDALG
HYARFLRTAAEHRPLASVSLLARRTGATCIEARLAVGASTPIPARLRRAEAFLAGKAVTP
EVAAEAADIVAADIDPVSDMRGNADYRREMVRTVARRSIATLFGLATD