Protein Info for RR42_RS13570 in Cupriavidus basilensis FW507-4G11

Annotation: hydroxyacylglutathione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 TIGR03413: hydroxyacylglutathione hydrolase" amino acids 5 to 266 (262 residues), 304.9 bits, see alignment E=1.9e-95 PF00753: Lactamase_B" amino acids 14 to 178 (165 residues), 54.1 bits, see alignment E=2.1e-18 PF16123: HAGH_C" amino acids 179 to 266 (88 residues), 91.5 bits, see alignment E=3.6e-30

Best Hits

Swiss-Prot: 81% identical to GLO2_CUPTR: Hydroxyacylglutathione hydrolase (gloB) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 81% identity to cti:RALTA_A1995)

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YDG9 at UniProt or InterPro

Protein Sequence (267 amino acids)

>RR42_RS13570 hydroxyacylglutathione hydrolase (Cupriavidus basilensis FW507-4G11)
MLKVEPIPAFQDNYIWAIHDGHCAAVVDPGESAPVEAFLAREGLTLGAIVITHHHGDHQG
GVAGLLAVHPTAPDGAPLPVIGPAGERIGARTVAVREGDTVNVAHPSLQLKVLDVPGHTA
GHVAYVADLPGAGPSVFCGDTLFASGCGRLFEGSPAQMLSSLDKLAALPGATRVYCAHEY
TRSNVRFARAVEPHNAELAAWEARVDALRAVGAPTVPTTIGQEREVNPFLRSRVPAVREA
VAAHAGGVAGNDAAAFGALRGWKDDFR