Protein Info for RR42_RS13520 in Cupriavidus basilensis FW507-4G11

Annotation: carbamoyl phosphate synthase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01368: carbamoyl-phosphate synthase, small subunit
  • amino acids 8 to 374 (367 residues), 482.5 bits, E=3.7e-149
• PF00988: CPSase_sm_chain
  • amino acids 10 to 135 (126 residues), 176.6 bits, E=2.7e-56
• PF00117: GATase
  • amino acids 195 to 371 (177 residues), 178.3 bits, E=2.1e-56
• PF07722: Peptidase_C26
  • amino acids 249 to 283 (35 residues), 20.6 bits, 4.9e-08

Best Hits

Swiss-Prot: 85% identical to CARA_RALSO: Carbamoyl-phosphate synthase small chain (carA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01956, carbamoyl-phosphate synthase small subunit [EC: 6.3.5.5] (inferred from 93% identity to reu:Reut_A2177)

MetaCyc: 66% identical to carbamoyl-phosphate synthetase small subunit (Escherichia coli K-12 substr. MG1655)
Carbamoyl-phosphate synthase (glutamine-hydrolyzing). [EC: 6.3.5.5]

Predicted SEED Role

"Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)" in subsystem De Novo Pyrimidine Synthesis or Macromolecular synthesis operon (EC 6.3.5.5)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• superpathway of arginine and polyamine biosynthesis (15/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• UMP biosynthesis I (6/6 steps found)
• UMP biosynthesis II (6/6 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• UMP biosynthesis III (5/6 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• allantoin degradation IV (anaerobic) (4/9 steps found)
• guadinomine B biosynthesis (2/13 steps found)

KEGG Metabolic Maps

• Glutamate metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Sequence Analysis Tools

See A0A0C4YDE8 at UniProt or InterPro

Protein Sequence (378 amino acids)

>RR42_RS13520 carbamoyl phosphate synthase small subunit (Cupriavidus basilensis FW507-4G11)
MLPSFPSAILALADGTVFRGYSIGASGHTIGEVVFNTALTGYQEILTDPSYSRQIVTLTY
PHIGNVGVNTEDVEATKVHAAGLIIKDLPLLASNFRKEHSLGHYLKQEKVVAIAGIDTRK
LTRILREKGAQNGCILAGEDNVQKAIDLARSFPGLAGMDLAKVVSVKEPYEWNQTEWVLG
QGYGKLESPRFHVVAFDYGVKFNILRMLAARGCKVTVLPAQASAEDALALNPDGVFLSNG
PGDPEPCDYAIRATREFIARGIPTFGICLGHQIMALAAGAKTLKMKFGHHGANHPVKDLD
DGRVVITSQNHGFAVDADTLPANVRATHVSLFDGSLQGFALTDKPAFCFQGHPEASPGPH
DVAYLFDRFTKMMADARQ