Protein Info for RR42_RS13500 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details PF13664: DUF4149" amino acids 19 to 118 (100 residues), 74.5 bits, see alignment E=3.6e-25

Best Hits

KEGG orthology group: None (inferred from 85% identity to reh:H16_A2450)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YB72 at UniProt or InterPro

Protein Sequence (167 amino acids)

>RR42_RS13500 membrane protein (Cupriavidus basilensis FW507-4G11)
MFSSSYSSLPPLPHRIFLLLTVVWAGSLWTVGYMVAPTLFSVLPSRETAGLIAGQLFRTE
AILGVVVGVLQLALCNLMIRRGAGRYRGLRWLVLGMLLCVLAGYFGIQPFMENLKEKATA
LGMGVSESPYKGQFGMLHGVSSVFYLVHSLLALVTVWRAAAPRSAGE