Protein Info for RR42_RS13465 in Cupriavidus basilensis FW507-4G11

Annotation: phosphate transporter permease subunit PstC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 75 to 102 (28 residues), see Phobius details amino acids 114 to 140 (27 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 227 to 251 (25 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 21 to 312 (292 residues), 294.5 bits, see alignment E=3.5e-92 PF00528: BPD_transp_1" amino acids 98 to 311 (214 residues), 47.3 bits, see alignment E=1e-16

Best Hits

Swiss-Prot: 73% identical to PSTC_ECOLI: Phosphate transport system permease protein PstC (pstC) from Escherichia coli (strain K12)

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 94% identity to reu:Reut_A2166)

MetaCyc: 73% identical to phosphate ABC transporter membrane subunit PstC (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YB20 at UniProt or InterPro

Protein Sequence (321 amino acids)

>RR42_RS13465 phosphate transporter permease subunit PstC (Cupriavidus basilensis FW507-4G11)
MATTSDLSAVRPPSRTGDILFGGLTRGAAIVTLLLLGGIIVSLAISAWPSIEAFGLRFLW
TAEWDPPADVYGALVPIYGTIVTSLIALIIAVPISFGIALFLTELSPAWLRRPLGTAIEL
LAAVPSIVYGMWGLLVFSPIFGEYFQKPLAATVGQVPLIGKLFQGAPLGIGLLCAGVILA
IMIIPYIASVMRDVFEVTPVLLKESAYGIGCTTWEVMWRVVLPFTRAGVIGGVMLGLGRA
LGETMAVTFVIGNTNLLDNASLFSPGNSITSALANEFAEAGAGLHTAALMELGLILFFIT
FVVLALSKILLLRLAKSEGAK