Protein Info for RR42_RS13460 in Cupriavidus basilensis FW507-4G11

Annotation: phosphate transporter permease subunit PtsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 36 to 58 (23 residues), see Phobius details amino acids 91 to 116 (26 residues), see Phobius details amino acids 129 to 153 (25 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 38 to 299 (262 residues), 267.4 bits, see alignment E=6e-84 PF00528: BPD_transp_1" amino acids 109 to 299 (191 residues), 76.2 bits, see alignment E=1.4e-25

Best Hits

Swiss-Prot: 70% identical to PSTA_ECOLI: Phosphate transport system permease protein PstA (pstA) from Escherichia coli (strain K12)

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 91% identity to cti:RALTA_A1973)

MetaCyc: 70% identical to phosphate ABC transporter membrane subunit PstA (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y477 at UniProt or InterPro

Protein Sequence (300 amino acids)

>RR42_RS13460 phosphate transporter permease subunit PtsA (Cupriavidus basilensis FW507-4G11)
MNQAAMSSSSTSIPAVSPDADATRTRLQARRRRTNFYALTASLGAMGFGLFWLAWILWTT
ISLGVGGLSMDLFTQMTPAPNTAGGGLANAIYGSFVMVGFATLCGTPLGILAGIYLAEYG
KTSPLASFIRFINDILLSAPSIVIGLFVYALVVTRMGHFSAWAGICALALLQIPIVVRTT
ENMLNLVPNALREAAFALGTPKWKMVLSITVKSSYAGIVTGVLLAVARIAGETAPLLFTA
LSNQFWTSDLNKPMANLPVTIFRFAMSPFVEWQQLAWAGVFLITVGVLALNILARMLFKK