Protein Info for RR42_RS13235 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 65 to 90 (26 residues), see Phobius details amino acids 111 to 148 (38 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 251 (171 residues), 94.6 bits, see alignment E=3.2e-31

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 92% identity to reh:H16_A2381)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y443 at UniProt or InterPro

Protein Sequence (263 amino acids)

>RR42_RS13235 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MAFRPDSKGMLRFWQLLVLVVILGAWHAATRSQQVAFFFGEPLMVAQRIWNWFVVERDIY
VHLGVTLIETLLAFGIGTAAGLGVGLWLALSPLTSAILDPYIKAMNSMPRVILAPIFAVW
FGLGIWSKVALAVTLVFFIVFFNVYQGVKEVSPVVLANVRMLGANRKQLLRHVYLPSATS
WVFSSLHTSVGLAFVGAVVGEYLGSARGVGYLILQAEGTFDINTVFAGIVVLTAAALMLD
TLVGSVEKRLMKWQPKSGETERL