Protein Info for RR42_RS13170 in Cupriavidus basilensis FW507-4G11

Annotation: 23S rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 PF05958: tRNA_U5-meth_tr" amino acids 262 to 436 (175 residues), 61.2 bits, see alignment E=4.7e-21

Best Hits

Swiss-Prot: 86% identical to RLMD_CUPNJ: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 86% identity to reu:Reut_A2092)

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YD69 at UniProt or InterPro

Protein Sequence (442 amino acids)

>RR42_RS13170 23S rRNA methyltransferase (Cupriavidus basilensis FW507-4G11)
MVQIHSLDMEARGVGRLVNEDGSPGKVIFVEGALPGETVSYSSFKRKASFEQANLGMIKK
ASPMRVKPGCEYFGVCGGCSMQHLDARAQVAIKQRVLEDDLWHLSKLHPDVVFRPIAGPD
WGYRYRARLTVRYVAKKGVALVGFHERKSSYVADMTSCKVLPPHVSDLLVPLRELITGLS
IRDRLPQVELAVGQDVTVLVLRILMPLTEHDEALLRAFADQHGVQFWLQPKGPDTVVPFY
PLDRELAYTLPEFSIRMPFKPTDFTQVNHQINRALIGRALRLLDVQPDDRLLDLFCGIGN
FTLPLATRGRSVMGIEGSEVLTTRALANAAINGLDHKTEFACRNLFEVGAQDIAALGRFD
RWLIDPPREGALAVSKALGELAQAGSDVLPKRIVYVSCNPATLARDAGVLVHEAGYRLSG
AGVVNMFPHTSHVESIAVFDRG