Protein Info for RR42_RS13135 in Cupriavidus basilensis FW507-4G11

Annotation: histidyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 TIGR00442: histidine--tRNA ligase" amino acids 33 to 436 (404 residues), 506.2 bits, see alignment E=3.5e-156 PF13393: tRNA-synt_His" amino acids 36 to 338 (303 residues), 162.1 bits, see alignment E=3e-51 PF00587: tRNA-synt_2b" amino acids 100 to 344 (245 residues), 67 bits, see alignment E=3.6e-22 PF03129: HGTP_anticodon" amino acids 356 to 453 (98 residues), 39.7 bits, see alignment E=6.9e-14

Best Hits

Swiss-Prot: 88% identical to SYH_CUPNJ: Histidine--tRNA ligase (hisS) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 88% identity to reu:Reut_A2085)

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y429 at UniProt or InterPro

Protein Sequence (462 amino acids)

>RR42_RS13135 histidyl-tRNA synthetase (Cupriavidus basilensis FW507-4G11)
MNQPVNPAAASDGAKAADSKAESKSKAVKALQGVKGMNDMLPADAPLWEHFENASRAMLR
AYGYQQVRTPIVEHTQLFVRGIGEVTDIVEKEMYSFTDALNGEQLTLRPEGTAAAVRATI
EHNLLYDGPKRLWYTGPMFRHERPQRGRYRQFHQLGAEALGFAGPDVDAEIIMMCQRLWD
DLGLVGVRLELNSLGQAEERAAHREELIKYLEGFQDILDEDSKRRLYTNPLRVLDTKNPA
LQEMASNAPKLIDFLGEESLAHFDGVQRLLKANNIPFKINPRLVRGLDYYNLTVFEWITD
KLGAQGTIAGGGRYDPLIAQMGGKAAPACGWAMGIERIIELLREEKLVPQAEGADVYLVH
QGEAAGQQAMIIAERLRDAGLDVLLHATPDGKSGSFKSQMKRADGSGAAYAVIIGEDEVV
AGTAQVKDLRQGAQAEGGGAQVTVAAEKLVDHIIDAMVGASE