Protein Info for RR42_RS13125 in Cupriavidus basilensis FW507-4G11

Annotation: pyrrolo-quinoline quinone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 2 to 370 (369 residues), 457.7 bits, see alignment E=1.2e-141 PF13360: PQQ_2" amino acids 7 to 87 (81 residues), 25.7 bits, see alignment E=1.3e-09 amino acids 79 to 299 (221 residues), 215.6 bits, see alignment E=1.2e-67 PF13570: PQQ_3" amino acids 40 to 76 (37 residues), 22.6 bits, see alignment 1.8e-08 amino acids 80 to 117 (38 residues), 18.1 bits, see alignment 4.5e-07 amino acids 119 to 158 (40 residues), 31.3 bits, see alignment 3e-11 PF01011: PQQ" amino acids 61 to 88 (28 residues), 23 bits, see alignment (E = 7.8e-09) amino acids 107 to 136 (30 residues), 20.7 bits, see alignment (E = 3.9e-08)

Best Hits

Swiss-Prot: 65% identical to BAMB_RALP1: Outer membrane protein assembly factor BamB (bamB) from Ralstonia pickettii (strain 12D)

KEGG orthology group: None (inferred from 82% identity to cti:RALTA_A1906)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAU8 at UniProt or InterPro

Protein Sequence (373 amino acids)

>RR42_RS13125 pyrrolo-quinoline quinone (Cupriavidus basilensis FW507-4G11)
MAAACAASVASLGGCSLFSKADKRTPVELKPITQTLSVRQAWKASVGKSGPYSLQPSVSG
GTVYASSNGGKVLALDGVTGRTLWEAKTDIDLTSGPGSDGTVTAVAGEKGAVFAFDASGK
QIWKKQVNGEVLSAPLVGNGLVVVRTTDTRVLGLDAQTGERRWIYQRSQTPLNLRASMGM
VFAGDGIVMGFPGGKLGVLAPGNGVLRWESTVSYPKGVSEIERLNDVTGQPMVNGRQVCA
TTFQGRIACLELANGQPQWGKDFSSPTGPAQDDTSLYAGDERSVVHAFDRQNGTERWKND
QLLYRRLGTPLAVGRSVVAGDYEGYVHFLSREDGQFVARLKTDGSEITAAPVVAGPSLVV
QTRDGNLYGFVPD