Protein Info for RR42_RS13090 in Cupriavidus basilensis FW507-4G11

Annotation: adenylosuccinate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 TIGR00184: adenylosuccinate synthase" amino acids 13 to 444 (432 residues), 574.7 bits, see alignment E=5.9e-177 PF00709: Adenylsucc_synt" amino acids 13 to 438 (426 residues), 589.8 bits, see alignment E=1.3e-181

Best Hits

Swiss-Prot: 94% identical to PURA1_CUPNJ: Adenylosuccinate synthetase 1 (purA1) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K01939, adenylosuccinate synthase [EC: 6.3.4.4] (inferred from 94% identity to rme:Rmet_2096)

MetaCyc: 61% identical to adenylosuccinate synthetase (Escherichia coli K-12 substr. MG1655)
Adenylosuccinate synthase. [EC: 6.3.4.4]

Predicted SEED Role

"Adenylosuccinate synthetase (EC 6.3.4.4)" in subsystem CBSS-262719.3.peg.410 or Purine conversions (EC 6.3.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y423 at UniProt or InterPro

Protein Sequence (446 amino acids)

>RR42_RS13090 adenylosuccinate synthetase (Cupriavidus basilensis FW507-4G11)
MSASAVSQGRNVVVIGTQWGDEGKGKIVDWLTDHAKGVVRFQGGHNAGHTLIIGGKKTIL
RLIPSGIMREGTICYIGNGVVLSPEALFREIEELETAGLQVQNRLRISEATTLILPYHVA
IDKAREVRRGADKIGTTGRGIGPAYEDKVARRALRVQDLFDPKCFAEKLRENLDLHNFML
TQYLGAQAVDFQQTLDEMLAYAPRLAPMVADVSAELYAVNAAGGNLMFEGAQGTLLDVDH
GTYPFVTSSNCVAGAAAAGAGVGPGRLNYILGITKAYCTRVGAGPFPSELYDNDNPKRQD
PVGVRLANVGKEFGSVTGRPRRTGWLDAAALKRSVQINGVSGLCMTKLDVLDGLETLKLC
VGYELDGKTVDILPRGSDAVARCVPVYEEFPGWNESTFGVKAWDALPEQARTYLKRVEEV
VGIPIDMISTGPDRDETILLRHPYVA