Protein Info for RR42_RS12920 in Cupriavidus basilensis FW507-4G11

Annotation: carbonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 856 transmembrane" amino acids 174 to 191 (18 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 457 to 479 (23 residues), see Phobius details amino acids 485 to 515 (31 residues), see Phobius details amino acids 804 to 821 (18 residues), see Phobius details amino acids 827 to 849 (23 residues), see Phobius details PF12156: ATPase-cat_bd" amino acids 34 to 117 (84 residues), 68.3 bits, see alignment E=1.7e-22 PF00403: HMA" amino acids 130 to 186 (57 residues), 38.8 bits, see alignment 1.9e-13 TIGR01511: copper-translocating P-type ATPase" amino acids 259 to 848 (590 residues), 446.1 bits, see alignment E=4.2e-137 TIGR01525: heavy metal translocating P-type ATPase" amino acids 277 to 848 (572 residues), 499.7 bits, see alignment E=2.6e-153 TIGR01494: HAD ATPase, P-type, family IC" amino acids 312 to 574 (263 residues), 116.4 bits, see alignment E=2.4e-37 amino acids 623 to 830 (208 residues), 111.5 bits, see alignment E=7e-36 PF00122: E1-E2_ATPase" amino acids 341 to 519 (179 residues), 162.9 bits, see alignment E=1.2e-51 PF00702: Hydrolase" amino acids 538 to 759 (222 residues), 79.1 bits, see alignment E=1.2e-25

Best Hits

KEGG orthology group: K01533, Cu2+-exporting ATPase [EC: 3.6.3.4] (inferred from 76% identity to reh:H16_A2321)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoI; Copper-translocating P-type ATPase (EC 3.6.3.4)" (EC 3.6.3.4)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.4

Use Curated BLAST to search for 3.6.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAN7 at UniProt or InterPro

Protein Sequence (856 amino acids)

>RR42_RS12920 carbonate dehydratase (Cupriavidus basilensis FW507-4G11)
MPTSPAPVFSARSLPNPPLARASSASAAAGRAGCFHCGQPLVAGEPPLHASIDGEEQAFC
CGGCQALAQTLHAAGFGHLYGDQARFARPIDDAARREAEPVWAAYDTEELRAQFVRALDE
RRAEITLAPENIRCAACAWLIEQHLGSLPGVESVIANVATRRVVVRWRAAEQPVSALLAA
LAGIGYLAWPFEVSRSDRQDRHARRGLLMRMAVAMLGMMQVMMYAWPIYTHEATIDPGQL
QLMRWASLVLTLPVVLYSASPIFAGAWRGLRQRHLGMDVPVALGVGAGFVASTVATLRGT
GEVYFDSVTMFVAFLLLARYLELRVRQASRSGAEMLARQLPATCERLRAEGGAGERVPVA
RLRAGDLIRVKAGEVVPADATVIAGASELDESMLTGESRPVPRGIGDPVLAGCFNTASPL
ELRVAKVGAGTRLAEIVAVLDRALAEKPRLATVADRVAGWFVAILLVLAAVTGAVWWAWI
DPARALLVTVAVLVVSCPCALSLATPAALAAAGAALSRRGLLLTRGHALETLASVTDVML
DKTGTLTQGRFALVRTQSNGDADADADAATCLRLAAAMERSGEHPIARGIVEAAQAQGLG
HETLAIDAMRNVPGQGLEADLDGRRYRLGRREFVEALCEHGSAANWHAELAGSERRGATL
VWLGSAAGTLAVFELADVAREQSARLLSELRALGVTCHLVSGDTPATVGWWADHFQISRR
EGGVTPEGKREYVARLQRGGAVVLAVGDGINDAPVLAQAQVSIAIGSGAPLAQAGADAVL
THGRVAEIANALKMARRARSVVRQNLAWAFAYNVIAIPLAATGYVTAWMAGIGMSVSSLL
VVANAWRLLRAGKPGD