Protein Info for RR42_RS12805 in Cupriavidus basilensis FW507-4G11

Annotation: C-5 sterol desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 134 to 151 (18 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 87 to 221 (135 residues), 106 bits, see alignment E=1.1e-34

Best Hits

KEGG orthology group: None (inferred from 84% identity to reh:H16_A2293)

Predicted SEED Role

"Sterol desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YCW8 at UniProt or InterPro

Protein Sequence (298 amino acids)

>RR42_RS12805 C-5 sterol desaturase (Cupriavidus basilensis FW507-4G11)
MTPSTIDPGLILLAFAPVFLLTIGAEAWYWARRDPAIYSLRDTASNAALALMHQASDAFF
LWLMVRTVYTWSYQHGLKAMPQTVWSFLLLLLLQDFLYYWFHRASHRVRWMWASHVTHHS
SEGMNFSTAFRQSLTYPLSGMWLFWIPLALIGFTPDWVILAVGLNLAFQFFVHTRLGGRW
HRLEWLFNTPSVHRVHHARNPQYIDRNYAGVLTAWDRMFGSFVPEEAPPEYGITRRIASH
NPITLTFHEWGDMFADAWRHRDLRHLWKPPEWRHPRDLAARDVPLAGTASGTDRSQDA