Protein Info for RR42_RS12790 in Cupriavidus basilensis FW507-4G11

Annotation: ACP phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF03358: FMN_red" amino acids 7 to 148 (142 residues), 140.9 bits, see alignment E=2.6e-45 PF02525: Flavodoxin_2" amino acids 7 to 115 (109 residues), 32.8 bits, see alignment E=5.9e-12

Best Hits

Swiss-Prot: 62% identical to CHRR_PSEPK: Quinone reductase (chrR) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 88% identity to reu:Reut_A2018)

MetaCyc: 62% identical to quinone reductase (Pseudomonas putida KT2440)
RXN0-5330 [EC: 1.6.5.9]

Predicted SEED Role

"NADPH:quinone oxidoreductase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YGZ0 at UniProt or InterPro

Protein Sequence (186 amino acids)

>RR42_RS12790 ACP phosphodiesterase (Cupriavidus basilensis FW507-4G11)
MSTPRDVAVLVGSLRKDSFNRKLALALAAMAPAGLKLDIVEIGQLPLYNQDEDASPPAPW
VAFRDRIRCADAVLFVTPEYNRSVPAALKNAIDVGSRPYGQSAWDGKPGGVISASPGAVG
GFGANHHLRQSLVFLNIPVLQQPEAYISGVDKLFDEQGGIANESTRGFLGKYLATYAAWI
ERNAAR