Protein Info for RR42_RS12705 in Cupriavidus basilensis FW507-4G11

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF00158: Sigma54_activat" amino acids 98 to 262 (165 residues), 236.2 bits, see alignment E=3.5e-74 PF14532: Sigma54_activ_2" amino acids 111 to 267 (157 residues), 62.5 bits, see alignment E=1e-20 PF07728: AAA_5" amino acids 119 to 240 (122 residues), 22.6 bits, see alignment E=1.9e-08

Best Hits

KEGG orthology group: K01529, [EC: 3.6.1.-] (inferred from 84% identity to reh:H16_A2683)

Predicted SEED Role

"Sigma-54 dependent DNA-binding response regulator"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAJ7 at UniProt or InterPro

Protein Sequence (435 amino acids)

>RR42_RS12705 transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MKLFNQGGSVGSAISYAGLIEKIEILRSTLRWASKLERTEIEKLLKQATTLRDEVMQLSH
KERFVQAAVAEPVPADLAPRERRQALLERSFIFEGTFGDNPKLLEALEIAEKAAPTDLPV
LIDGESGTGKELMAKVIHANGSRTDKPYISVNCGAIPENLLESELFGHKKGAFTGAANDR
RGKFESAHTGTIFLDEIGELPLTGQVKLLRVLESHEIQRVGSDETISVDTRIVAATNRDL
RRLSEEGKFREDLFYRLSVIHVTLPPLRERRDEIALLVAYFGDEAAGALKRRPVKLTPRL
RDFLMNYAYPGNIRELRNLMYRTSCLAGDTADLEHLPQDLRPKPSAPAPVTSGAAAPLVV
DASTATSLSEAKRAASDEAERAFLERGLQEVGGTVAELARRFDMNRSHLQMLLKKHGIHS
KDFRNQGAAQGGKAR